GHRH analog

Sermorelin

Name: Sermorelin
Brand: Vitro Sciences
SKU: 86168-78-7
Availability: InStock

GHRH (1–29)

Prices and ordering require an account. Create an account or sign in.

Net quantity

CAS: 86168-78-7
Length: 29 residues
Net content: 5 mg
Form: Lyophilized powder for reconstitution
Documentation: HPLC-MS · COA per lot

Each vial carries its own lot number — for example 87C-3420 — printed on the label. Look up a lot to see what its certificate reports.

Supplied for in-vitro laboratory research use only. Not for human or veterinary use, and not intended to diagnose, treat, cure, or prevent any disease.

Specifications

Molecular formula: C149H246N44O42S
Average mass: 3357.9 Da
Monoisotopic mass: 3355.8187 Da
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Sequence (three-letter): H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2

Counter-ion, water content and purity are lot-specific and are reported on the lot’s certificate of analysis.

Reconstitution

Reconstitute with sterile water to the working concentration your protocol calls for. Swirl gently; do not shake. For laboratory research only.

Storage

Store each vial as its label states; keep powder vials desiccated and protected from light. Stable to the retest date on the Certificate of Analysis under stated conditions.

Documentation

Each lot is analyzed by RP-HPLC and ESI-MS. Enter the vial's lot to pull its Certificate of Analysis: identity, purity, and net content for that exact lot.

Verify a lot →